BDBM50570308 CHEMBL4863865
SMILES CNc1nc(C)c(s1)-c1nc(Nc2cccc(c2)N2CCN(CC2)C(C)=O)ncc1Br
InChI Key InChIKey=JJUAVZQHRBSKOY-UHFFFAOYSA-N
Data 2 KI
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 1 hit for monomerid = 50570308
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 7.5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair